PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G295800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 784aa    MW: 82015.9 Da    PI: 7.0548
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G295800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.7e-095605971954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Brast02G295800.1.p 560 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 597
                         554459******************************88 PP

2BELL120.38.6e-39421491272
                BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         r e+q+kkakL+s+l+eVd+rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia+q+
  Brast02G295800.1.p 421 RFEHQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIASQL 491
                         779******************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.3E-70340489IPR006563POX domain
PfamPF075264.1E-53345488IPR006563POX domain
PROSITE profilePS5007112.6538601IPR001356Homeobox domain
SMARTSM003891.5E-9541605IPR001356Homeobox domain
CDDcd000863.45E-13541602No hitNo description
SuperFamilySSF466892.99E-17543608IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-28544607IPR009057Homeodomain-like
PfamPF059204.0E-18558597IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 784 aa     Download sequence    Send to blast
MGIAAPPCQP PTTTHVSQPK SSSGGAAIRP ATEAYSMSHS QGFHQQGSSG VYGFSSDGFV  60
DRPGSSSQAD QQQEQQHVAQ QSRRDKLRVQ QGFVDPGAAG GAAHGLLPLD GDEHGGAMYD  120
HAAAAGASNM LAEMFNFSAH QAPPPSATEL LASQMNSASY RFGFRQAPPG PGDGGWFGPA  180
GARAGGGLVL GGPAHLGPLG EASSSPKHQQ QAGGAMAGLA ATDPAAAMQL FLMNPQQQQQ  240
SRSSPTSPPP SDAQSAIQHH EAFQAFGGVV EGHGQGLSLS LSPSLQQLEM AKQQAEELRV  300
RDGVLYFNRQ QQQVQQQLPM ALHGGQVGPL AVAGHVGYGP GPAGVLRNSK YTRAAQELLD  360
EFCSVGRGGQ TIKQAGRGAA GSASNPNAGK GGGGGASSSG AAQSPSSASK MEPPQLSPAD  420
RFEHQRKKAK LISMLDEVDR RYNHYCDQMQ MVVNFFDSVM GFGAATPYTA LAQKAMSRHF  480
RCLKDAIASQ LRHTCELLGE KDAGTSSGLT KGETPRLRAI DQSLRQQRAF HHMGMMEQEA  540
WRPQRGLPER SVSILRSWLF EHFLHPYPSD ADKHLLARQT GLSRNQVSNW FINARVRLWK  600
PMIEEMYQQE TKELEGSSAG AGGPESGNND PSGAADEMHS PNAQPQGVLM QHGAGSRYGH  660
QQQQQEHHQH GMAMLSGVHP HKLDPGAVAG PSSDAAAFVG LDPAELLAGG DVVGGGDDLY  720
GRFEAAGVRM RYGPGPGPGP GPAATAGTAA GDVSLTLGLQ HAGPGNAGPD GSGRFSLRDY  780
SGC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B1e-16547604158Homeobox protein Meis1
4xrs_A1e-16547604158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5466420.0AB546642.1 Triticum aestivum WBLH1-2 mRNA for BEL1-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230386.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLI1GNM30.0I1GNM3_BRADI; Uncharacterized protein
STRINGBRADI1G09615.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-127BEL1-like homeodomain 4